Pearson Reading Street First Grade PDF Free Download

1y ago

36 Views

1 Downloads

3.33 MB

102 Pages

Report/dmca

Download PDF

Transcription

Pearson ReadingStreetFirst GradeUnits 1-5 Spelling andVocabulary Lists

Pearson ReadingStreetFirst GradeUnit 1 Spelling andVocabulary Lists

Unit 1, Week 1“Sam, Come Back!”genre: realistic fiction This week’s skills: phonics: short vowel a; consonantpattern –ck comprehension: character & setting conventions: sentencesSpelling sackcomeinmyonway

Unit 1, Week 2“Pig in a Wig”genre: animal fantasy This week’s skills: phonics: short vowel i; consonant x comprehension: plot conventions: subjects of sentencesSpelling igshetakeupwhatSelectionVocabularyplayto perform on a musicalinstrument

Unit 1, Week 3“The Big Blue Ox”genre: animal fantasy This week’s skills: phonics: short vowel o; plural –s;consonant s /z/ comprehension: character & setting conventions: predicates of sentencesSpelling wna large group of housesand buildings, smallerthan a city

Unit 1, Week 4“A Fox and a Kit”genre: literary nonfiction This week’s skills: phonics: inflected endings –ing & -s comprehension: main ideas & details conventions: declarative sentencesSpelling tswinwinseatfivefourherthistooSelection Vocabularyanimalsliving things that can move arounddinnerthe main meal of the daywatchto look at something

Unit 1, Week 5“Get the Egg!”genre: realistic fiction This week’s skills: phonics: short vowel e; initial consonantblends comprehension: main ideas & details conventions: interrogative sentencesSpelling l covered infeathers that has wingsand two legs

Unit 1, Week 6“Animal Park”genre: literary nonfiction This week’s skills: phonics: short vowel u; final consonantblends comprehension: cause & effect conventions: exclamatory sentencesSpelling ustlumpmusttrusthomeintomanythemSelection Vocabularyelephantshuge, strong land animals with gray skin andlong trunkshipposa short word for hippopotamuses, which arelarge animals with short legs, thick skins, andwide mouthsparkland set aside for people to enjoy naturezebrasblack-and-white striped animals that look likehorses

Pearson ReadingStreetFirst GradeUnit 2 Spelling andVocabulary Lists

Unit 2, Week 1“A Big Fish for Max”genre: animal fantasySpelling Wordsfishrushshellshipshopshutthenthintrashwith This week’s skills: phonics: consonant digraphs sh & th comprehension: sequence conventions: common ction VocabularyGrandmahelps Max and Ruby solve their problemsMaxRuby’s little brotherRubyMax’s big sister who is sometimes alittle bossy

Unit 2, Week 2“The Farmer in theHat”genre: realistic fictionSpelling Wordsagecagecakefacelatemademakenamesafetake This week’s skills: phonics: long vowel a;consonants c /s/ & g /j/ comprehension: cause & effect conventions: proper ction Vocabularyfarmera person who grows crops or keepsanimals on a farmgerbila small, furry animal often kept as a petsqueaka short, high sound

Unit 2, Week 3“Who Works Here?”genre: expository text This week’s skills: phonics: long vowel i;consonant digraphs wh, ch, tch, ph comprehension: author’s purpose conventions: special titlesSpelling esmiletimewhiteliveoutpeoplewhoworkSelection Vocabularybusyhaving many things to domailletters or packages sent through apost office and delivered to homes orbusinessesneighborhooda place where people live and worktogether

Unit 2, Week 4“The Big Circle”genre: fiction This week’s skills: phonics: long vowel o; contractions comprehension: sequence conventions: proper nouns (days,months, holidays)Spelling n Vocabularybabya very young child or animalcirclea round shape, like a ringherda group of animals of the same kind that staytogethermeata kind of food that comes from animalstriceratopsa large plant-eating dinosaur that had 3 horns

Unit 2, Week 5“Life in the Forest”genre: expository text This week’s skills: phonics: long vowels e & u; inflectedending -ed comprehension: author’s purpose conventions: singular & plural nounsHigh-FrequencyWordsSpelling dfindfoodgrowunderwaterSelection Vocabularybearlarge, heavy animal with thick furforesta large piece of land covered in treesand plantshummingbirda very small bird whose wingsmake a humming soundleavesthe flat green parts of a plantsquirrelssmall animals with bushy tails that canclimb treeswoodpeckera bird with a hard, pointed bill

This week’s skills: phonics: long vowel e (e & ee);syllables vccv comprehension: compare & contrast conventions: nouns in sentencesUnit 2, Week 6“Honey Bees”genre: expository textHigh-FrequencyWordsSpelling thersometheirSelection Vocabularycoldnot warm; the opposite of hotflowersparts of plants that make seeds andfruit and often have brightly colored petalshoneynectarworkerjobs a lota sweet liquid made by beesa sweet liquid made by flowersa person or animal that does tasks or

Unit 2, Week 5“Life in the Forest”genre: expository textSpelling WordscubecuteflutehugeJunemuleruderuletubeuse This week’s skills: phonics: long vowels e & u; inflectedending -ed comprehension: author’s purpose conventions: singular & plural uirrelswoodpecker

Unit 2, Week 6“Honey Bees”genre: expository textSpelling Wordsbefeetgreenhemeseeshetreeweweek This week’s skills: phonics: long vowel e (e & ee);syllables vccv comprehension: compare & contrast conventions: nouns in er

Pearson ReadingStreetFirst GradeUnit 3 Spelling andVocabulary Lists

This week’s skills: phonics: vowel sounds of y;syllable pattern cv comprehension: sequence conventions: action verbsUnit 3, Week 1“A Place to Play”genre: realistic fictionHigh-FrequencyWordsSpelling ecomedayeverythingnothingstaysthingsSelection Vocabularyartpainting, drawing, or sculptureboya male childgrewgot biggernowat this timesunsetlast time of the day when the sun isseentowertall building or part of a building

This week’s skills:Unit 3, Week 2 phonics: consonant patterns –ng, -nk;compound words“Ruby In Her Own Time” comprehension: compare & contrastgenre: animal fantasy conventions: verbs that add -sSpelling ction Vocabularybeautiful very pretty to see or hearfather a man who has a child or childrenfeather one of the light, soft things thatcovers a bird’s bodyflew took off and moved in the airhowling making a loud, whining soundmother a woman who has a child or childrennightthe time between sunset and sunriseprecioushaving great value

Unit 3, Week 3“The Class Pet”genre: expository text This week’s skills: phonics: r-controlled or, ore;ending –es, plural -es comprehension: fact & opinion conventions: verbs that do not add -sHigh-FrequencyWordsSpelling shesawaycarfriendshouseourschoolverySelection Vocabularybrownthe color of soil or chocolatefurthe hair that covers the bodies of someanimalsmousea small, furry animal with a pointedsnout and a thin, bare tailteachesgives information or explains howto do something

Unit 3, Week 4“Frog and ToadTogether”genre: animal fantasy This week’s skills: phonics: r-controlled: ar; adding endings comprehension: author’s purpose conventions: verbs for past & for futureHigh-FrequencyWordsSpelling annedafraidagainfewhowreadsoonSelection Vocabularyground the soil or dirt on the surface ofthe earthheadthe top part of your body or the frontpart of most animals’ bodiesrainwater that falls in drops from thecloudsshoutedcalled out or yelled loudlyshoutingcalling or yelling

Unit 3, Week 5“I’m a Caterpillar”genre: literary nonfiction This week’s skills: phonics: r-controlled: er, ir, ur;contractions comprehension: fact & opinion conventions: verbs am, is, are, was, wereSpelling tshirtsirweredoneknowpushvisitwaitSelection Vocabularycaterpillaran insect that changes into amoth or butterflychrysalisforms from the body of acaterpillar and has a hard shell that protectsthe pupa as it changes into a butterflycrawlto move on your hands and knees orwith your body close to the groundpupathe form of an insect while it ischanging from a wormlike larva into an adultshiverto shake

Unit 3, Week 6“Where Are My AnimalFriends?”genre: drama This week’s skills: phonics: consonant pattern –dge;comparative endings –er & -est comprehension: draw conclusions conventions: contractions with notHigh-FrequencyWordsSpelling ’tSelection Vocabularybutterflygoosean insect with colored wingsa large bird with a long neckraccoona small animal with thick fur whosemarkings look like rings on its tail and a blackmask around its eyesspringthe season after winter, when plantsbegin to growwarmmore hot than cold

Unit 3, Week 1“A Place to Play”genre: realistic fictionSpelling Wordsbycryflyhandyluckymypuppysillysunnytry This week’s skills: phonics: vowel sounds of y;syllable pattern cv comprehension: sequence conventions: action unsettower

Unit 3, Week 3“The Class Pet”genre: expository textSpelling shes This week’s skills: phonics: r-controlled or, ore;ending –es, plural -es comprehension: fact & opinion conventions: verbs that do not add erySelectionVocabularybrownfurmouseteaches

Unit 3, Week 4“Frog and ToadTogether”genre: animal fantasySpelling anned This week’s skills: phonics: r-controlled: ar; adding endings comprehension: author’s purpose conventions: verbs for past & for SelectionVocabularygroundheadrainshoutedshouting

Unit 3, Week 6“Where Are My AnimalFriends?”genre: dramaSpelling rshortesttallertallest This week’s skills: phonics: consonant pattern –dge;comparative endings –er & -est comprehension: draw conclusions conventions: contractions with warm

This week’s skills: phonics: vowel sounds of y;syllable pattern cv comprehension: sequence conventions: action verbsUnit 3, Week 1“A Place to Play”genre: realistic fictionSpelling Words aysthingsThe silly puppyalways plays onsunny days.Selection Vocabularyartpainting, drawing, or sculptureboya male childgrewgot biggernowat this timesunsetlast time of the day when the sun isseentowertall building or part of a building

This week’s skills:Unit 3, Week 2 phonics: consonant patterns –ng, -nk;compound words“Ruby In Her Own Time” comprehension: compare & contrastgenre: animal fantasy conventions: verbs that add -sSpelling Words Can you bring thepink trunk to therink?Selection Vocabularybeautiful very pretty to see or hearfather a man who has a child or childrenfeather one of the light, soft things thatcovers a bird’s bodyflew took off and moved in the airhowling making a loud, whining soundmother a woman who has a child or childrennightthe time between sunset and sunriseprecioushaving great value

Unit 3, Week 3“The Class Pet”genre: expository text This week’s skills: phonics: r-controlled or, ore;ending –es, plural -es comprehension: fact & opinion conventions: verbs that do not add -sSpelling Words choolveryThe classes wishthe school buswas far away.Selection Vocabularybrownthe color of soil or chocolatefurthe hair that covers the bodies of someanimalsmousea small, furry animal with a pointedsnout and a thin, bare tailteachesgives information or explains howto do something

Unit 3, Week 4“Frog and ToadTogether”genre: animal fantasy This week’s skills: phonics: r-controlled: ar; adding endings comprehension: author’s purpose conventions: verbs for past & for futureSpelling Words oonThe boy plannedto drop the ballagain.Selection Vocabularygroundthe soil or dirt on the surface ofthe earthheadthe top part of your body or the frontpart of most animals’ bodiesrainwater that falls in drops from thecloudsshoutedcalled out or yelled loudlyshoutingcalling or yelling

Unit 3, Week 5“I’m a Caterpillar”genre: literary nonfiction This week’s skills: phonics: r-controlled: er, ir, ur;contractions comprehension: fact & opinion conventions: verbs am, is, are, was, wereSpelling Words rhurtshirtsirweredoneknowpushvisitwaitThe girl has aburn on her shirt!Selection Vocabularycaterpillaran insect that changes into amoth or butterflychrysalisforms from the body of acaterpillar and has a hard shell that protectsthe pupa as it changes into a butterflycrawlto move on your hands and knees orwith your body close to the groundpupathe form of an insect while it ischanging from a wormlike larva into an adultshiverto shake

Unit 3, Week 6“Where Are My AnimalFriends?”genre: drama This week’s skills: phonics: consonant pattern –dge;comparative endings –er & -est comprehension: draw conclusions conventions: contractions with notSpelling Words edoesgood-byeohrightwon’tThe tallest girlran faster thanthe shortest boy.Selection Vocabularybutterflygoosean insect with colored wingsa large bird with a long neckraccoona small animal with thick fur whosemarkings look like rings on its tail and a blackmask around its eyesspringthe season after winter, when plantsbegin to growwarmmore hot than cold

Unit 3, Week 1“A Place to Play”genre: realistic fiction This week’s skills: phonics: vowel sounds of y;syllable pattern cv comprehension: sequence conventions: action verbsSpelling Words aysthingsThe silly puppyalways plays onsunny days.SelectionVocabularyartboygrewnowsunsettower

Pearson ReadingStreetFirst GradeUnit 4 Spelling andVocabulary Lists

This week’s skills: phonics: vowel digraphs ai & ay;singular & plural possessives comprehension: draw conclusions conventions: adjectivesUnit 4, Week 1“Mama’s BirthdayPresent”genre: realistic fictionHigh-FrequencyWordsSpelling enjoygivesurpriseworrywouldSelection Vocabularybreak smash or break somethingbuñuelos pastries that are fried and covered withsugarconfetti bits of colored paper thrown duringcelebrationsguitar a stringed musical instrumentpiñata an object filled with candy, fruit, or smalltoys. Blindfolded people swing sticks at it to break itopen.present a gift given to someonetortilla a thin, flat, round cake made with cornmealwonderful marvelous, enjoyable

Unit 4, Week 2“Cinderella”genre: fairy tale This week’s skills: phonics: vowel digraph ea; adding endings comprehension: theme conventions: adjectives for colors &shapesHigh-FrequencyWordsSpelling olorsdrawdrewgreatovershowsignSelection Vocabularycastle large building with high walls and towerscoach a big carriage with seats that is pulled byhorseshappily with joy; with good fortunemarried when two people are married, they becomehusband and wifeprince the son of a king or queenpumpkin a large, roundish, orange fruit that growson a vinetwelve o’clock either midday or midnight, whennight ends or morning beginswoman a grown-up girl who is an adult

This week’s skills:Unit 4, Week 3 phonics: vowel digraphs oa & ow;3-letter consonant blends“A Trip to Washington, D.C.” comprehension: facts & detailsgenre: expository text conventions: adjectives for sizeSpelling gh-FrequencyWordsfoundmouthoncetookwildSelection Vocabularycapitalthe center of governmentfor a country or statecountrythe land of a group ofpeople with one governmentdocumentspapers that recordinformation or factsgovernmenta group of people whorule a country, state, or city

Unit 4, Week 4“A Southern Ranch”genre: expository text This week’s skills: phonics: vowel digraphs ie, igh;consonant patterns kn & wr comprehension: facts & details conventions: adjectives for what kindSpelling n Vocabularycattlecows, bulls, and steerscowanimal of the ox family raised formeat or milkfrontthe leading position in a linepointthe rider at the front of theherd when rounding up cattleroundupact of driving or bringingcattle togethersoldexchanged for money

Unit 4, Week 5“Peter’s Chair”genre: realistic fiction This week’s skills: phonics: vowel digraphs ue, ew, ui;compound words comprehension: theme conventions: adjectives for how many & articlesSpelling ordspicturerememberroomstoodthoughtSelection Vocabularybiscuitssmall treats for dogscookiessmall, flat sweet cakescradlea small bed for a bobycrocodilea large reptile with a longbody, short legs, a long snout and tail,and sharp teethcurtainideaa cloth hung across a windowa plan

This week’s skills: phonics: vowel sound in moon (oo);“Henry and Mudgesuffixes –ly & -fuland Mrs. Hopper’s House” comprehension: cause & effectgenre: realistic fiction conventions: adjectives that compareUnit 4, Week 6Spelling usedanceonlyopenedshoestoldSelection Vocabularygargoylea stone carving in the shape of ascary person or animalheartthe shape of a candy or card givenon Valentine’s Dayshinybrighttuxedoa formal suit for men, usuallyblackwaltzto dance slowly and gracefully

Unit 4, Week 1“Mama’s BirthdayPresent”genre: realistic fictionSpelling Wordsafraiddaygraymailmayplayraintailtrainway This week’s skills: phonics: vowel digraphs ai & ay;singular & plural possessives comprehension: draw conclusions conventions: tiguitarpiñatapresenttortillawonderful

Unit 4, Week 2“Cinderella”genre: fairy tale This week’s skills: phonics: vowel digraph ea; adding endings comprehension: theme conventions: adjectives for colors &shapesSpelling umpkintwelve o’clockwoman

Unit 4, Week 4“A Southern Ranch”genre: expository textSpelling Wordsbrighthighlielightmightnightpierighttietight This week’s skills: phonics: vowel digraphs ie, igh;consonant patterns kn & wr comprehension: facts & details conventions: adjectives for what ectionVocabularycattlecowfrontpointroundupsold

Unit 4, Week 5“Peter’s Chair”genre: realistic fictionSpelling erselfinsidelunchboxoutsidesuitcase This week’s skills: phonics: vowel digraphs ue, ew, ui;compound words comprehension: theme conventions: adjectives for how many & ocodilecurtainidea

This week’s skills: phonics: vowel digraphs ai & ay;singular & plural possessives comprehension: draw conclusions conventions: adjectivesUnit 4, Week 1“Mama’s BirthdayPresent”genre: realistic fictionSpelling Words Don’t be afraidto play on a grayday!Selection Vocabularybreak smash or break somethingbuñuelos pastries that are fried and covered withsugarconfetti bits of colored paper thrown duringcelebrationsguitar a stringed musical instrumentpiñata an object filled with candy, fruit, or smalltoys. Blindfolded people swing sticks at it to break itopen.present a gift given to someonetortilla a thin, flat, round cake made with cornmealwonderful marvelous, enjoyable

Unit 4, Week 2“Cinderella”genre: fairy tale This week’s skills: phonics: vowel digraph ea; adding endings comprehension: theme conventions: adjectives for colors &shapesHigh-FrequencyWordsSpelling Words eatWe need a teamto clean thebeach by the sea.colorsdrawdrewgreatovershowsignSelection Vocabularycastle large building with high walls and towerscoach a big carriage with seats that is pulled byhorseshappily with joy; with good fortunemarried when two people are married, they becomehusband and wifeprince the son of a king or queenpumpkin a large, roundish, orange fruit that growson a vinetwelve o’clock either midday or midnight, whennight ends or morning beginswoman a grown-up girl who is an adult

This week’s skills:Unit 4, Week 3 phonics: vowel digraphs oa & ow;3-letter consonant blends“A Trip to Washington, D.C.” comprehension: facts & detailsgenre: expository text conventions: adjectives for sizeSpelling Words roadrowsnowsoapyellowfoundmouthoncetookwildDo you need youryellow coat to godown the road inthe snow?Selection Vocabularycapitalthe center of governmentfor a country or statecountrythe land of a group ofpeople with one governmentdocumentspapers that recordinformation or factsgovernmenta group of people whorule a country, state, or city

Unit 4, Week 4“A Southern Ranch”genre: expository text This week’s skills: phonics: vowel digraphs ie, igh;consonant patterns kn & wr comprehension: facts & details conventions: adjectives for what kindSpelling Words tnightpierighttietightaboveeightlaughmoontouchThe moon mightbe bright in thesky at night.Selection Vocabularycattlecows, bulls, and steerscowanimal of the ox family raised formeat or milkfrontthe leading position in a linepointthe rider at the front of theherd when rounding up cattleroundupact of driving or bringingcattle togethersoldexch

Pearson Reading Street First Grade Units 1-5 Spelling and Vocabulary Lists. Pearson Reading Street First Grade Unit 1 Spelling and Vocabulary Lists. Spelling Words am at back bat can cat dad mad ran sack High-Frequency Words come in m